PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00111624001
Common NameGSBRNA2T00111624001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 101aa    MW: 11616.1 Da    PI: 5.8971
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00111624001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.81.2e-282982256
              G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
                          r++W+++LHerF++ave+L G+++A+Pk+i+e+m+v+gLt+ +v+SHLQkYRl+
  GSBRNA2T00111624001 29 SRVVWSQQLHERFLDAVEHL-GINHAVPKRIMEFMDVDGLTRVEVASHLQKYRLY 82
                         69******************.9*******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.6212584IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-282686IPR009057Homeodomain-like
SuperFamilySSF466894.48E-202786IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-262881IPR006447Myb domain, plants
PfamPF002491.1E-73080IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 101 aa     Download sequence    Send to blast
MREDDSNWFA GWEKELPSQL QLPSSQANSR VVWSQQLHER FLDAVEHLGI NHAVPKRIME  60
FMDVDGLTRV EVASHLQKYR LYLQKMHEDD LMHAGVGSIS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-202486163ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00111624001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894311e-143AC189431.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB068B07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298091.12e-28hypothetical protein CARUB_v10014134mg
SwissprotQ9SNB43e-23PCL1_ARATH; Transcription factor LUX
TrEMBLA0A078CAU49e-70A0A078CAU4_BRANA; BnaA03g31420D protein
STRINGBra001378.1-P2e-63(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15903712
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.14e-28G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]